Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR3H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | POLR3H |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
POLR3H Polyclonal specifically detects POLR3H in Human samples. It is validated for Western Blot.Specifications
POLR3H | |
Polyclonal | |
Rabbit | |
B0QYH9 | |
171568 | |
Synthetic peptides corresponding to POLR3H(polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)) The peptide sequence was selected from the middle region of POLR3H. Peptide sequence AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide, DNA-directed RNA polymerase III subunit H, DNA-directed RNA polymerase III subunit RPC8, KIAA1665MGC29654, MGC111097, polymerase (RNA) III (DNA directed) polypeptide H (22.9kD), RNA nucleotidyltransferase (DNA-directed), RNA polymerase III subunit 22.9 kDa subunit, RNA polymerase III subunit C8, RNA polymerase III subunit RPC8, RPC8RPC22.9 | |
POLR3H | |
IgG | |
This product is specific to Subunit or Isoform: RPC8. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title