POLR3H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213787

Catalog No. NBP213787

Description

POLR3H Polyclonal specifically detects POLR3H in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POLR3H
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide, DNA-directed RNA polymerase III subunit H, DNA-directed RNA polymerase III subunit RPC8, KIAA1665MGC29654, MGC111097, polymerase (RNA) III (DNA directed) polypeptide H (22.9kD), RNA nucleotidyltransferase (DNA-directed), RNA polymerase III subunit 22.9 kDa subunit, RNA polymerase III subunit C8, RNA polymerase III subunit RPC8, RPC8RPC22.9
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: POLR3H
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG
• Quantity: 0.1 mL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 171568
• Target Species: Human
• Isotype: IgG

For Research Use Only