POLR3H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438286	Novus Biologicals NBP21378725UL	25ul
NBP213787	Novus Biologicals NBP213787	0.1 mL

Description

POLR3H Polyclonal specifically detects POLR3H in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POLR3H
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide, DNA-directed RNA polymerase III subunit H, DNA-directed RNA polymerase III subunit RPC8, KIAA1665MGC29654, MGC111097, polymerase (RNA) III (DNA directed) polypeptide H (22.9kD), RNA nucleotidyltransferase (DNA-directed), RNA polymerase III subunit 22.9 kDa subunit, RNA polymerase III subunit C8, RNA polymerase III subunit RPC8, RPC8RPC22.9
• Gene Symbols: POLR3H
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: DNA replication Transcription Translation and Splicing
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 171568
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVG
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only