Learn More
Poly-Ubiquitin Rabbit anti-Human, Mouse, Rat, Clone: 5Y8J0, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | Poly-Ubiquitin |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 5Y8J0 |
| Conjugate | Unconjugated |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | CEP80, HEL112, ribosomal protein S27a, RPS27A, S27A, UBA80, UBC, UBCEP1, UBCEP80 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of K48-linkage Specific Ubiquitin (P0CG47).,, Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.