Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Poly-Ubiquitin Rabbit anti-Human, Mouse, Rat, Clone: 5Y8J0, Novus Biologicals™

Rabbit Monoclonal Antibody

$205.50 - $494.50

Specifications

Antigen	Poly-Ubiquitin
Clone	5Y8J0
Applications	Western Blot, Immunofluorescence
Classification	Monoclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB167556 View Documents View Product Certificates	Novus Biologicals NBP31623220UL	20 μg	Each for $205.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB167555 View Documents View Product Certificates	Novus Biologicals NBP316232100UL	100 μg	Each for $494.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Poly-Ubiquitin Monoclonal antibody specifically detects Poly-Ubiquitin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

Antigen	Poly-Ubiquitin
Applications	Western Blot, Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human, Mouse, Rat
Gene Alias	CEP80, HEL112, ribosomal protein S27a, RPS27A, S27A, UBA80, UBC, UBCEP1, UBCEP80
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of K48-linkage Specific Ubiquitin (P0CG47).,, Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Clone	5Y8J0
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Formulation	PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene ID (Entrez)	6233
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Poly-Ubiquitin Rabbit anti-Human, Mouse, Rat, Clone: 5Y8J0, Novus Biologicals™

Specifications

Description

Specifications

Documents