POMGNT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174108

Catalog No. NBP174108

Description

POMGNT1 Polyclonal specifically detects POMGNT1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: POMGNT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp761B182, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.101, FLJ20277, GnT I.2, MDDGA3, MDDGB3, MDDGC3, MEB, MGAT1.2GNTI.2, POMGnT1, protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase, protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1, UDP-GlcNAc:alpha-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I.2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55624
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q91X88
• Gene Symbols: POMGNT1
• Immunogen: Synthetic peptides corresponding to the N terminal of Pomgnt1. Immunizing peptide sequence LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Bovine: 85%; Equine: 85%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG