Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POMGNT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	POMGNT1
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP174108 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP174108	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

POMGNT1 Polyclonal specifically detects POMGNT1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	POMGNT1
Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	DKFZp761B182, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.101, FLJ20277, GnT I.2, MDDGA3, MDDGB3, MDDGC3, MEB, MGAT1.2GNTI.2, POMGnT1, protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase, protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1, UDP-GlcNAc:alpha-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I.2
Gene Symbols	POMGNT1
Isotype	IgG

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q91X88
Gene ID (Entrez)	55624
Immunogen	Synthetic peptides corresponding to the N terminal of Pomgnt1. Immunizing peptide sequence LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

POMGNT1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents