Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. POR/Cytochrome P450 Reductase Antibody, Novus Biologicals™

POR/Cytochrome P450 Reductase Antibody, Novus Biologicals™
SDP

Catalog No. NBP15977920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15977920 20 μL
NBP159779 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15977920 Supplier Novus Biologicals Supplier No. NBP15977920UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

POR/Cytochrome P450 Reductase Polyclonal specifically detects POR/Cytochrome P450 Reductase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen POR/Cytochrome P450 Reductase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q63HL4
Gene Alias CPR, CYPORFLJ26468, DKFZp686G04235, EC 1.6.2.4, NADPH--cytochrome P450 reductase, NADPH-dependent cytochrome P450 reductase, P450 (cytochrome) oxidoreductase, P450R
Gene Symbols POR
Host Species Rabbit
Immunogen Synthetic peptides corresponding to POR(P450 (cytochrome) oxidoreductase) The peptide sequence was selected from the N terminal of POR. Peptide sequence IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5447
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.