POR/Cytochrome P450 Reductase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15977920UL

Catalog No. NBP15977920

Description

POR/Cytochrome P450 Reductase Polyclonal specifically detects POR/Cytochrome P450 Reductase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POR/Cytochrome P450 Reductase
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q63HL4
• Gene Symbols: POR
• Immunogen: Synthetic peptides corresponding to POR(P450 (cytochrome) oxidoreductase) The peptide sequence was selected from the N terminal of POR. Peptide sequence IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CPR, CYPORFLJ26468, DKFZp686G04235, EC 1.6.2.4, NADPH--cytochrome P450 reductase, NADPH-dependent cytochrome P450 reductase, P450 (cytochrome) oxidoreductase, P450R
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5447
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG