Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POR/Cytochrome P450 Reductase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | POR/Cytochrome P450 Reductase |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15977920
|
Novus Biologicals
NBP15977920UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP159779
|
Novus Biologicals
NBP159779 |
100 μL |
Each for $487.50
|
|
|||||
Description
POR/Cytochrome P450 Reductase Polyclonal specifically detects POR/Cytochrome P450 Reductase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| POR/Cytochrome P450 Reductase | |
| Polyclonal | |
| Purified | |
| RUO | |
| CPR, CYPORFLJ26468, DKFZp686G04235, EC 1.6.2.4, NADPH--cytochrome P450 reductase, NADPH-dependent cytochrome P450 reductase, P450 (cytochrome) oxidoreductase, P450R | |
| POR | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Q63HL4 | |
| 5447 | |
| Synthetic peptides corresponding to POR(P450 (cytochrome) oxidoreductase) The peptide sequence was selected from the N terminal of POR. Peptide sequence IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title