PORCN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159677

Catalog No. NBP159677

Description

PORCN Polyclonal antibody specifically detects PORCN in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

• Antigen: PORCN
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2410004O13Rik, DHOF, EC 2.3.1.-, FODH, MG61PPNprobable protein-cysteine N-palmitoyltransferase porcupine, por, PORCMGC29687, porcupine homolog (Drosophila), Protein MG61
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:300
• Gene Accession No.: Q9H237-4
• Gene Symbols: PORCN
• Immunogen: Synthetic peptides corresponding to PORCN(porcupine homolog (Drosophila)) The peptide sequence was selected from the N terminal of PORCN (NP_073736). Peptide sequence ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 64840
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only