Potassium channel subfamily K member 6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP23406325UL

Catalog No. NB397265

Description

Potassium channel subfamily K member 6 Polyclonal specifically detects Potassium channel subfamily K member 6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Potassium channel subfamily K member 6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9Y257
• Gene Symbols: KCNK6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDY
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Inward rectifying potassium channel protein TWIK-2, K2p6.1, K2P6.1 potassium channel, potassium channel subfamily K member 6, potassium channel, subfamily K, member 6, TOSSFLJ12282, TWIK-2, TWIK2KCNK8, TWIK-originated similarity sequence, TWIK-originated sodium similarity sequence
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9424
• Target Species: Human
• Isotype: IgG

For Research Use Only