Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. POU3F2/OCT7 Antibody (CL6232), Novus Biologicals™

POU3F2/OCT7 Antibody (CL6232), Novus Biologicals™
SDP

Catalog No. NBP261437 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP261437 100 μL
NB393101 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP261437 Supplier Novus Biologicals Supplier No. NBP261437
Only null left
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

POU3F2/OCT7 Monoclonal specifically detects POU3F2/OCT7 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen POU3F2/OCT7
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL6232
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Brain-2, Brain-specific homeobox/POU domain protein 2, brn-2, BRN2brain-2, Nervous system-specific octamer-binding transcription factor N-Oct-3, Oct-7, OCT7POU domain class 3, transcription factor 2, Octamer-binding protein 7, Octamer-binding transcription factor 7, OTF7, OTF-7, POU class 3 homeobox 2, POU domain, class 3, transcription factor 2, POUF3
Gene Symbols POU3F2
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP
Purification Method Protein A purified
Quantity 100 μL
Research Discipline Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 5454
Test Specificity Specificity of human POU3F2/OCT7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.