POU3F3 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309359100UL

Catalog No. NB123619

Description

POU3F3 Polyclonal specifically detects POU3F3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: POU3F3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Alias: brain-1, Brain-specific homeobox/POU domain protein 1, Brn-1, BRN1brn-1, Oct-8, Octamer-binding protein 8, Octamer-binding transcription factor 8, OTF-8, OTF8oct-8, POU class 3 homeobox 3, POU domain class 3, transcription factor 3, POU domain, class 3, transcription factor 3
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat POU3F3 (NP_620192). Peptide sequence VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5455
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.