Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POU3F3 Rabbit anti-Human, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | POU3F3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
POU3F3 Polyclonal specifically detects POU3F3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| POU3F3 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Human, Rat | |
| brain-1, Brain-specific homeobox/POU domain protein 1, Brn-1, BRN1brn-1, Oct-8, Octamer-binding protein 8, Octamer-binding transcription factor 8, OTF-8, OTF8oct-8, POU class 3 homeobox 3, POU domain class 3, transcription factor 3, POU domain, class 3, transcription factor 3 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Rat POU3F3 (NP_620192). Peptide sequence VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 5455 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title