POU5F1P1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255475

Catalog No. NBP255475

Description

POU5F1P1 Polyclonal specifically detects POU5F1P1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: POU5F1P1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: OCT4-PG1, Octamer-binding protein 3-like, Octamer-binding transcription factor 3-like, OTF3Coctamer binding protein 3_like sequence, OTF3P1, POU 5 domain protein, POU class 5 homeobox 1 pseudogene 1, POU class 5 homeobox 1B, POU domain class 5, transcription factor 1 pseudogene 1, POU domain transcription factor Oct-4, POU domain transcription factor OCT4-pg1, POU domain, class 5, transcription factor 1 pseudogene 1, POU5F1P1, POU5F1P4, POU5FLC20, POU5FLC8, putative POU domain, class 5, transcription factor 1B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5462
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: POU5F1B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only