Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PP1 Inhibitor-2 Antibody, Novus Biologicals™

PP1 Inhibitor-2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17988920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17988920 20 μL
NBP179889 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17988920 Supplier Novus Biologicals Supplier No. NBP17988920UL

Description

Rabbit Polyclonal Antibody

PP1 Inhibitor-2 Polyclonal specifically detects PP1 Inhibitor-2 in Human samples. It is validated for Western Blot.

Specifications

Antigen PP1 Inhibitor-2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_006232
Gene Alias IPP-2, IPP2phosphatase inhibitor 2, MGC87148, phosphoprotein phosphatase, protein phosphatase 1, regulatory (inhibitor) subunit 2, protein phosphatase inhibitor 2
Gene Symbols PPP1R2
Host Species Rabbit
Immunogen The specific Immunogen is proprietary information. Peptide sequence ASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYH.
Molecular Weight of Antigen 23 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Protein Phosphatase
Primary or Secondary Primary
Gene ID (Entrez) 5504
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.