PP2A alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24669325UL

Catalog No. NB396356

Description

PP2A alpha Polyclonal antibody specifically detects PP2A alpha in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PP2A alpha
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 3.1.3.16, PP2A-alpha, PP2Ac, PP2CA, PP2Calpha, protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, protein phosphatase 2, catalytic subunit, alpha isozyme, protein phosphatase 2A catalytic subunit, alpha isoform, Replication protein C, RP-C, serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYF
• Quantity: 25 μL
• Research Discipline: Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Neuronal Cell Markers, Neurotransmission, Protein Phosphatase, Signal Transduction
• Gene ID (Entrez): 5515
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified