Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PP2C epsilon/PPM1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18724725UL
Description
PP2C epsilon/PPM1L Polyclonal specifically detects PP2C epsilon/PPM1L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PP2C epsilon/PPM1L | |
Polyclonal | |
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
EC 3.1.3, EC 3.1.3.16, MGC132545, MGC132547, PP2C epsilon, PP2CEProtein phosphatase 2C isoform epsilon, PP2C-epsilon, PPM1-LIKE, protein phosphatase 1 (formerly 2C)-like, protein phosphatase 1L, Protein phosphatase 1-like, Protein phosphatase 2C epsilon isoform, protein phosphatase, Mg2+/Mn2+ dependent, 1L | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PPM1L | |
This antibody was developed against Recombinant Protein corresponding to amino acids:DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK | |
25 μL | |
Protein Phosphatase | |
151742 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction