PP2C epsilon/PPM1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406157	Novus Biologicals NBP18724725UL	25 μL
NBP187247	Novus Biologicals NBP187247	0.1 mL

Description

PP2C epsilon/PPM1L Polyclonal specifically detects PP2C epsilon/PPM1L in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PP2C epsilon/PPM1L
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 3.1.3, EC 3.1.3.16, MGC132545, MGC132547, PP2C epsilon, PP2CEProtein phosphatase 2C isoform epsilon, PP2C-epsilon, PPM1-LIKE, protein phosphatase 1 (formerly 2C)-like, protein phosphatase 1L, Protein phosphatase 1-like, Protein phosphatase 2C epsilon isoform, protein phosphatase, Mg2+/Mn2+ dependent, 1L
• Gene Symbols: PPM1L
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Protein Phosphatase
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 151742
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only