PPAP2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159011

Catalog No. NBP159011

Description

PPAP2A Polyclonal specifically detects PPAP2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPAP2A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.1.3.4, lipid phosphate phosphohydrolase 1, lipid phosphate phosphohydrolase 1a, LLP1a, LPP1PAP2a2, PAP2, PAP2a, PAP2-alpha, PAP-2aPAP2alpha2, PAPalpha1, Phosphatidate phosphohydrolase type 2a, Phosphatidic acid phosphatase 2a, phosphatidic acid phosphatase type 2A, phosphatidic acid phosphohydrolase type 2a, type 2 phosphatidic acid phosphohydrolase, type-2 phosphatidic acid phosphatase alpha
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 85%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Guinea Pig
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: O14494-2
• Gene Symbols: PPAP2A
• Immunogen: Synthetic peptides corresponding to PPAP2A(phosphatidic acid phosphatase type 2A) The peptide sequence was selected from the N terminal of PPAP2A. Peptide sequence QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 8611
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only