PPAP2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25735025UL

Catalog No. NB394018

Description

PPAP2B Polyclonal specifically detects PPAP2B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PPAP2B
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
• Gene Alias: Dri42, EC 3.1.3.4, lipid phosphate phosphohydrolase 3, LPP3PAP2 beta, MGC15306, PAP2b, PAP-2b, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, phosphatidic acid phosphatase type 2B, type-2 phosphatidic acid phosphatase-beta, vascular endothelial growth factor and type I collagen inducible, Vascular endothelial growth factor and type I collagen-inducible protein, VCIP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PLPP3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM
• Quantity: 25 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 8613
• Target Species: Human
• Form: Purified

For Research Use Only