Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPAP2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $646.00

Specifications

Antigen	PPAP2B
Dilution	Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP257350 missing translation for 'viewDocuments' missing translation for 'viewProductCertificates' missing translation for 'viewAlternatives' missing translation for 'toSaveUpto'	Novus Biologicals NBP257350	100 μL	Each for $646.00	Only null left	Already have an account? Sign In to view your price and availability. New here? Register with us today! Add to cart

NB394018 missing translation for 'viewDocuments' missing translation for 'viewProductCertificates' missing translation for 'viewAlternatives' missing translation for 'toSaveUpto'	Novus Biologicals NBP25735025UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price and availability. New here? Register with us today! Add to cart

Description

PPAP2B Polyclonal specifically detects PPAP2B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	PPAP2B
Applications	Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Alias	Dri42, EC 3.1.3.4, lipid phosphate phosphohydrolase 3, LPP3PAP2 beta, MGC15306, PAP2b, PAP-2b, PAP2-beta, Phosphatidate phosphohydrolase type 2b, Phosphatidic acid phosphatase 2b, phosphatidic acid phosphatase type 2B, type-2 phosphatidic acid phosphatase-beta, vascular endothelial growth factor and type I collagen inducible, Vascular endothelial growth factor and type I collagen-inducible protein, VCIP
Gene Symbols	PLPP3
Isotype	IgG
Purification Method	Affinity Purified

Dilution	Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Protein Phosphatase
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	8613
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PPAP2B Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents