PPAPDC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256028

Catalog No. NBP256028

Description

PPAPDC3 Polyclonal specifically detects PPAPDC3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPAPDC3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C9orf67, chromosome 9 open reading frame 67, EC 3.1.3, EC 3.1.3.-, FLJ14662, KIAA0515, MGC12921, NET39, phosphatidic acid phosphatase type 2 domain containing 3, Phosphatidic acid phosphatase type 2 domain-containing protein 3, probable lipid phosphate phosphatase PPAPDC3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84814
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PLPP7
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only