Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPAR gamma/NR1C3 Antibody, Novus Biologicals™

PPAR gamma/NR1C3 Antibody, Novus Biologicals™
SDP

Catalog No. NB403364 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403364 25 μL
NBP257833 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403364 Supplier Novus Biologicals Supplier No. NBP25783325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PPAR gamma/NR1C3 Polyclonal specifically detects PPAR gamma/NR1C3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen PPAR gamma/NR1C3
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias CIMT1, NR1C3GLM1, Nuclear receptor subfamily 1 group C member 3, peroxisome proliferator-activated receptor gamma, peroxisome proliferator-activated receptor gamma 1, PPAR gamma, PPARG1peroxisome proliferative activated receptor, gamma, PPARG2PPARgamma, PPAR-gamma
Gene Symbols PPARG
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVC
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, mTOR Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5468
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.