Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPCDC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15648920UL
Description
PPCDC Polyclonal specifically detects PPCDC in Human samples. It is validated for Western Blot.Specifications
PPCDC | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96CD2 | |
PPCDC | |
Synthetic peptides corresponding to PPCDC(phosphopantothenoylcysteine decarboxylase) The peptide sequence was selected from the N terminal of PPCDC. Peptide sequence VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV. | |
20 μL | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
coaC, EC 4.1.1.36, FLJ14585, MDS018, phosphopantothenoylcysteine decarboxylase, PPC-DC | |
Rabbit | |
Protein A purified | |
RUO | |
60490 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction