Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPCDC Antibody, Novus Biologicals™
SDP

Catalog No. NBP15648920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15648920 20 μL
NBP156489 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15648920 Supplier Novus Biologicals Supplier No. NBP15648920UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

PPCDC Polyclonal specifically detects PPCDC in Human samples. It is validated for Western Blot.

Specifications

Antigen PPCDC
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96CD2
Gene Alias coaC, EC 4.1.1.36, FLJ14585, MDS018, phosphopantothenoylcysteine decarboxylase, PPC-DC
Gene Symbols PPCDC
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PPCDC(phosphopantothenoylcysteine decarboxylase) The peptide sequence was selected from the N terminal of PPCDC. Peptide sequence VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 60490
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.