Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPCDC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | PPCDC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15648920
|
Novus Biologicals
NBP15648920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156489
|
Novus Biologicals
NBP156489 |
100 μL |
Each for $487.50
|
|
|||||
Description
PPCDC Polyclonal specifically detects PPCDC in Human samples. It is validated for Western Blot.Specifications
| PPCDC | |
| Polyclonal | |
| Purified | |
| RUO | |
| coaC, EC 4.1.1.36, FLJ14585, MDS018, phosphopantothenoylcysteine decarboxylase, PPC-DC | |
| PPCDC | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Q96CD2 | |
| 60490 | |
| Synthetic peptides corresponding to PPCDC(phosphopantothenoylcysteine decarboxylase) The peptide sequence was selected from the N terminal of PPCDC. Peptide sequence VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title