PPCDC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156489

Catalog No. NBP156489

Description

PPCDC Polyclonal specifically detects PPCDC in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PPCDC
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: coaC, EC 4.1.1.36, FLJ14585, MDS018, phosphopantothenoylcysteine decarboxylase, PPC-DC
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 92%; Rat: 92%; Bovine: 85%; Chicken: 85%; Equine: 85%; Pig: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96CD2
• Gene Symbols: PPCDC
• Immunogen: Synthetic peptides corresponding to PPCDC(phosphopantothenoylcysteine decarboxylase) The peptide sequence was selected from the N terminal of PPCDC. Peptide sequence VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 60490
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG