Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPIL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP213794
Description
PPIL3 Polyclonal specifically detects PPIL3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
PPIL3 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Cyclophilin J, cyclophilin-like protein 3, Cyclophilin-like protein PPIL3, CyPJ, EC 5.2.1.8, peptidyl-prolyl cis-trans isomerase-like 3, peptidylprolyl cis-trans isomerase-like protein 3, peptidylprolyl isomerase (cyclophilin)-like 3, PPIase, PPIase-like protein 3, Rotamase PPIL3 | |
Rabbit | |
Affinity Purified | |
RUO | |
53938 | |
Human, Mouse, Rat | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
PPIL3 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANP | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction