PPIL3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438281	Novus Biologicals NBP21379425UL	25ul
NBP213794	Novus Biologicals NBP213794	0.1 mL

Description

PPIL3 Polyclonal specifically detects PPIL3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPIL3
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 53938
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Rat
• Gene Alias: Cyclophilin J, cyclophilin-like protein 3, Cyclophilin-like protein PPIL3, CyPJ, EC 5.2.1.8, peptidyl-prolyl cis-trans isomerase-like 3, peptidylprolyl cis-trans isomerase-like protein 3, peptidylprolyl isomerase (cyclophilin)-like 3, PPIase, PPIase-like protein 3, Rotamase PPIL3
• Gene Symbols: PPIL3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only