PPM1M Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25655525UL

Catalog No. NB403670

Description

PPM1M Polyclonal specifically detects PPM1M in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PPM1M
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: FLJ32332, PP2CEEC 3.1.3.16, PP2Ceta, PP2C-eta, PPM1E, protein phosphatase 1M, protein phosphatase 1M (PP2C domain containing), protein phosphatase 2C eta, protein phosphatase 2C eta-2, Protein phosphatase 2C isoform eta, protein phosphatase, Mg2+/Mn2+ dependent, 1M
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PPM1M
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMANA
• Quantity: 25 μL
• Research Discipline: Protein Phosphatase
• Gene ID (Entrez): 132160
• Target Species: Human
• Form: Purified

For Research Use Only