Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPM1M Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | PPM1M |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PPM1M Polyclonal specifically detects PPM1M in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PPM1M | |
Polyclonal | |
Rabbit | |
Protein Phosphatase | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
132160 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AFQECDEVIGRELEASGQMGGCTALVAVSLQGKLYMANA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
FLJ32332, PP2CEEC 3.1.3.16, PP2Ceta, PP2C-eta, PPM1E, protein phosphatase 1M, protein phosphatase 1M (PP2C domain containing), protein phosphatase 2C eta, protein phosphatase 2C eta-2, Protein phosphatase 2C isoform eta, protein phosphatase, Mg2+/Mn2+ dependent, 1M | |
PPM1M | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title