PPP1R11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170681

Catalog No. NBP170681

Description

PPP1R11 Polyclonal specifically detects PPP1R11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PPP1R11
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: PPP1R11
• Immunogen: Synthetic peptides corresponding to PPP1R11(protein phosphatase 1, regulatory (inhibitor) subunit 11) The peptide sequence was selected from the N terminal of PPP1R11. Peptide sequence MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 6992
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: HCG V, HCG-V, inhibitor-3, IPP3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, TCTE5, TCTEX5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 11.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG