Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPP1R11 Antibody, Novus Biologicals™

PPP1R11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1706820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1706820 20 μL
NBP170681 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1706820 Supplier Novus Biologicals Supplier No. NBP17068120UL

Description

Rabbit Polyclonal Antibody

PPP1R11 Polyclonal specifically detects PPP1R11 in Human samples. It is validated for Western Blot.

Specifications

Antigen PPP1R11
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias HCG V, HCG-V, inhibitor-3, IPP3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, TCTE5, TCTEX5
Gene Symbols PPP1R11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PPP1R11(protein phosphatase 1, regulatory (inhibitor) subunit 11) The peptide sequence was selected from the N terminal of PPP1R11. Peptide sequence MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDN.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6992
Test Specificity This product is specific to Subunit or Isoform: 11.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.