PPP1R12C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP194079

Catalog No. NBP194079

Description

PPP1R12C Polyclonal specifically detects PPP1R12C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPP1R12C
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: DKFZp434D0412, LENG3, leukocyte receptor cluster (LRC) encoded novel gene 3, leukocyte receptor cluster (LRC) member 3, MBS85, myosin-binding subunit 85, p84, p85, protein phosphatase 1 myosin-binding subunit of 85 kDa, protein phosphatase 1 myosin-binding subunit p85, protein phosphatase 1 regulatory subunit 12C, protein phosphatase 1, regulatory (inhibitor) subunit 12C, protein phosphatase 1, regulatory subunit 12C
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54776
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPP1R12C
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only