PPP1R15B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174269

Catalog No. NBP174269

Description

PPP1R15B Polyclonal specifically detects PPP1R15B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PPP1R15B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CREP, FLJ14744, protein phosphatase 1 regulatory subunit 15B, protein phosphatase 1, regulatory (inhibitor) subunit 15B
• Host Species: Rabbit
• Molecular Weight of Antigen: 79 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 15B.
• Target Species: Human, Bovine, Canine
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5SWA1
• Gene Symbols: PPP1R15B
• Immunogen: Synthetic peptides corresponding to the C terminal of PPP1R15B. Immunizing peptide sequence SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84919
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.