Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP1R15B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PPP1R15B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PPP1R15B Polyclonal specifically detects PPP1R15B in Human samples. It is validated for Western Blot.Specifications
PPP1R15B | |
Polyclonal | |
Rabbit | |
Q5SWA1 | |
84919 | |
Synthetic peptides corresponding to the C terminal of PPP1R15B. Immunizing peptide sequence SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL. | |
Primary | |
79 kDa |
Western Blot | |
Unconjugated | |
RUO | |
CREP, FLJ14744, protein phosphatase 1 regulatory subunit 15B, protein phosphatase 1, regulatory (inhibitor) subunit 15B | |
PPP1R15B | |
IgG | |
This product is specific to Subunit or Isoform: 15B. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title