Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP1R16B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31729625UL
This item is not returnable.
View return policy
Description
PPP1R16B Polyclonal antibody specifically detects PPP1R16B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
PPP1R16B | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
ANKRD4TIMAPankyrin repeat domain protein 4, Ankyrin repeat domain-containing protein 4, CAAX box protein TIMAP, hTIMAP, KIAA0823TGF-beta-inhibited membrane-associated protein, protein phosphatase 1 regulatory inhibitor subunit 16B, protein phosphatase 1, regulatory (inhibitor) subunit 16B | |
This antibody was developed against Recombinant Protein corresponding to amino acids: RASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKI | |
25 μg | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
26051 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction