Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP1R16B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
| Antigen | PPP1R16B |
|---|---|
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PPP1R16B Polyclonal antibody specifically detects PPP1R16B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| PPP1R16B | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ANKRD4TIMAPankyrin repeat domain protein 4, Ankyrin repeat domain-containing protein 4, CAAX box protein TIMAP, hTIMAP, KIAA0823TGF-beta-inhibited membrane-associated protein, protein phosphatase 1 regulatory inhibitor subunit 16B, protein phosphatase 1, regulatory (inhibitor) subunit 16B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKI | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS, pH 7.2, 40% glycerol | |
| 26051 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title