Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPP1R3A Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB169338 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB169338 100 μg
NB169339 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB169338 Supplier Novus Biologicals Supplier No. NBP317131100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Polyclonal Antibody

PPP1R3A Polyclonal antibody specifically detects PPP1R3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen PPP1R3A
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle, GM, PP1G, PPP1R3, protein phosphatase 1 glycogen- associated regulatory subunit, Protein phosphatase 1 glycogen-associated regulatory subunit, protein phosphatase 1 regulatory subunit 3A, protein phosphatase 1, regulatory (inhibitor) subunit 3A, protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen andsarcoplasmic reticulum binding subunit, skeletal muscle), Protein phosphatase type-1 glycogen targeting subunit, RG1, serine/threonine specific protein phosphatase, type-1 protein phosphatase skeletal muscle glycogen targeting subunit
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: EETTSNMGEIKPSLGDTSSDELVQLHTGSKEVLDDNANPAHGNGTMQIPCPSSDQLMAGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTSACLKESTEEG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5506
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.