PPP1R3A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31713125UL

Catalog No. NB169339

Description

PPP1R3A Polyclonal antibody specifically detects PPP1R3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: PPP1R3A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle, GM, PP1G, PPP1R3, protein phosphatase 1 glycogen- associated regulatory subunit, Protein phosphatase 1 glycogen-associated regulatory subunit, protein phosphatase 1 regulatory subunit 3A, protein phosphatase 1, regulatory (inhibitor) subunit 3A, protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen andsarcoplasmic reticulum binding subunit, skeletal muscle), Protein phosphatase type-1 glycogen targeting subunit, RG1, serine/threonine specific protein phosphatase, type-1 protein phosphatase skeletal muscle glycogen targeting subunit
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EETTSNMGEIKPSLGDTSSDELVQLHTGSKEVLDDNANPAHGNGTMQIPCPSSDQLMAGNLNKKHEGGAKKIEVKDLGCLRRDFHSDTSACLKESTEEG
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5506
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG