Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPP1R3B Antibody, Novus Biologicals™
SDP

Catalog No. NBP179917 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179917 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179917 Supplier Novus Biologicals Supplier No. NBP179917
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PPP1R3B Polyclonal specifically detects PPP1R3B in Human samples. It is validated for Western Blot.

Specifications

Antigen PPP1R3B
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_078883
Gene Alias FLJ14005, FLJ34675, GL, Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL, PPP1R4PP1 subunit R4, protein phosphatase 1 regulatory subunit 3B, Protein phosphatase 1 regulatory subunit 4, Protein phosphatase 1 subunit GL, protein phosphatase 1, regulatory (inhibitor) subunit 3B
Gene Symbols PPP1R3B
Host Species Rabbit
Immunogen The immunogen for this antibody is PPP1R3B. Peptide sequence LSSKNEASGMVAPAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMP.
Molecular Weight of Antigen 31 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 79660
Test Specificity Expected identity based on immunogen sequence: Rabbit: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.