PPP2R2C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169160

Catalog No. NBP169160

Description

PPP2R2C Polyclonal specifically detects PPP2R2C in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PPP2R2C
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B55-GAMMA, IMYPNO1, phosphoprotein phosphatase 2A BR gamma regulatory chain, PP2A subunit B isoform B55-gamma, PP2A subunit B isoform gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A, subunit B, B55-gamma isoform, PP2A, subunit B, B-gamma isoform, PP2A, subunit B, PR55-gamma isoform, PP2A, subunit B, R2-gamma isoform, PR55G, protein phosphatase 2, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gammaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform, protein phosphatase 2, regulatory subunit B, gamma, protein phosphatase 2A1 B gamma subunit, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, gammaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gammaisoform
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: B gamma isoform.
• Target Species: Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y2T4
• Gene Symbols: PPP2R2C
• Immunogen: Synthetic peptides corresponding to Ppp2r2c (protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform) The peptide sequence was selected from the N terminal of Ppp2r2c. Peptide sequence VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5522
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.