Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPP2R2C Antibody, Novus Biologicals™
SDP

Catalog No. NBP169160 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169160 100 μL
NBP16916020 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP169160 Supplier Novus Biologicals Supplier No. NBP169160
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PPP2R2C Polyclonal specifically detects PPP2R2C in Mouse samples. It is validated for Western Blot.

Specifications

Antigen PPP2R2C
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y2T4
Gene Alias B55-GAMMA, IMYPNO1, phosphoprotein phosphatase 2A BR gamma regulatory chain, PP2A subunit B isoform B55-gamma, PP2A subunit B isoform gamma, PP2A subunit B isoform PR55-gamma, PP2A subunit B isoform R2-gamma, PP2A, subunit B, B55-gamma isoform, PP2A, subunit B, B-gamma isoform, PP2A, subunit B, PR55-gamma isoform, PP2A, subunit B, R2-gamma isoform, PR55G, protein phosphatase 2, protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gammaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit B, gamma isoform, protein phosphatase 2, regulatory subunit B, gamma, protein phosphatase 2A1 B gamma subunit, serine/threonine protein phosphatase 2A, 55 KDA regulatory subunit B, gammaisoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gammaisoform
Gene Symbols PPP2R2C
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Ppp2r2c (protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform) The peptide sequence was selected from the N terminal of Ppp2r2c. Peptide sequence VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 49 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5522
Test Specificity This product is specific to Subunit or Isoform: B gamma isoform.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.