Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP2R2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP233379
Description
PPP2R2D Polyclonal specifically detects PPP2R2D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PPP2R2D | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q66LE6 | |
PPP2R2D | |
This antibody was developed against a recombinant protein corresponding to amino acids: FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM | |
0.1 mL | |
Protein Phosphatase | |
55844 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
KIAA1541, MDS026, PP2A subunit B isoform B55-delta, PP2A subunit B isoform delta, PP2A subunit B isoform PR55-delta, PP2A subunit B isoform R2-delta, protein phosphatase 2, regulatory subunit B, delta, protein phosphatase 2, regulatory subunit B, delta isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B deltaisoform | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction