Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PPP2R2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PPP2R2D |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PPP2R2D Polyclonal specifically detects PPP2R2D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PPP2R2D | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Q66LE6 | |
55844 | |
This antibody was developed against a recombinant protein corresponding to amino acids: FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Protein Phosphatase | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
KIAA1541, MDS026, PP2A subunit B isoform B55-delta, PP2A subunit B isoform delta, PP2A subunit B isoform PR55-delta, PP2A subunit B isoform R2-delta, protein phosphatase 2, regulatory subunit B, delta, protein phosphatase 2, regulatory subunit B, delta isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B deltaisoform | |
PPP2R2D | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title