Learn More
Description
Specifications
Specifications
| Antigen | PPP2R3A |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | PP2A subunit B isoform R3 isoform, PP2A subunit B isoforms B72/B130, PP2A subunit B isoforms B'-PR72/PR130, protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha, serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha, subunit B, R3 isoform |
| Gene Symbols | PPP2R3A |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCSEDLKKCTDIIKQCIKKKSGSSISEGSGNDTISSSETVYMNVMTRLA |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
