Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PPP2R5A Antibody, Novus Biologicals™

PPP2R5A Antibody, Novus Biologicals™
SDP

Catalog No. NBP15366320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15366320 20 μL
NBP153663 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15366320 Supplier Novus Biologicals Supplier No. NBP15366320UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

PPP2R5A Polyclonal specifically detects PPP2R5A in Human samples. It is validated for Western Blot.

Specifications

Antigen PPP2R5A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q15172
Gene Alias B56A, MGC131915, PP2A B subunit isoform B56-alpha, PP2A B subunit isoform B'-alpha, PP2A B subunit isoform PR61-alpha, PP2A B subunit isoform R5-alpha, PP2A, B subunit, B' alpha isoform, PP2A, B subunit, B56 alpha isoform, PP2A, B subunit, PR61 alpha isoform, PP2A, B subunit, R5 alpha isoform, PR61A, PR61alpha, protein phosphatase 2, regulatory subunit B (B56), alpha isoform, protein phosphatase 2, regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, alphaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
Gene Symbols PPP2R5A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PPP2R5A(protein phosphatase 2, regulatory subunit B', alpha isoform) The peptide sequence was selected from the N terminal of PPP2R5A. Peptide sequence YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5525
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.