PPP2R5B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18895825UL

Catalog No. NB431006

Description

PPP2R5B Polyclonal specifically detects PPP2R5B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPP2R5B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: B56B, FLJ35411, PP2A B subunit isoform B56-beta, PP2A B subunit isoform B'-beta, PP2A B subunit isoform PR61-beta, PP2A B subunit isoform R5-beta, PR61B, protein phosphatase 2, regulatory subunit B (B56), beta isoform, protein phosphatase 2, regulatory subunit B', beta, protein phosphatase 2, regulatory subunit B', beta isoform, serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, betaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human PPP2R5B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPP2R5B
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTP
• Quantity: 25 μL
• Research Discipline: Wnt Signaling Pathway
• Gene ID (Entrez): 5526
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only