Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PPP2R5C Antibody, Novus Biologicals™
SDP

Catalog No. NBP188961 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP188961 0.1 mL
NB431004 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP188961 Supplier Novus Biologicals Supplier No. NBP188961
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PPP2R5C Polyclonal specifically detects PPP2R5C in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PPP2R5C
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias B' alpha regulatory subunit, B56G, KIAA0044, MGC23064, PP2A B subunit isoform B56-gamma, PP2A B subunit isoform B'-gamma, PP2A B subunit isoform PR61-gamma, PP2A B subunit isoform R5-gamma, PR61G, protein phosphatase 2, regulatory subunit B (B56), gamma isoform, protein phosphatase 2, regulatory subunit B', gamma, protein phosphatase 2, regulatory subunit B', gamma isoform, Renal carcinoma antigen NY-REN-29, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
Gene Symbols PPP2R5C
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQAQKDPKKDRPLARRKSELPQDPHTKKALEAHC
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Neuronal Cell Markers, Neuroscience, Neurotransmission, Protein Phosphatase, Signal Transduction, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5527
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.