Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP258920

PPP3CB Antibody, Novus Biologicals™
SDP

Catalog No. NBP258920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP258920 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP258920 Supplier Novus Biologicals Supplier No. NBP258920
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PPP3CB Polyclonal specifically detects PPP3CB in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen PPP3CB
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias Calmodulin-dependent calcineurin A subunit beta isoform, CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta), CAM-PRP catalytic subunit, CNA2catalytic subunit, beta isoform, EC 3.1.3.16, protein phosphatase 2B, catalytic subunit, beta isoform, protein phosphatase 3, catalytic subunit, beta isozyme, protein phosphatase from PCR fragment H32, serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
Gene Symbols PPP3CB
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5532
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.