PPP3CC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP186656

Catalog No. NBP186656

Description

PPP3CC Polyclonal specifically detects PPP3CC in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PPP3CC
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500
• Gene Alias: Calcineurin, testis-specific catalytic subunit, Calmodulin-dependent calcineurin A subunit gamma isoform, CALNA3CAM-PRP catalytic subunit, CNA3, EC 3.1.3.16, PP2Bgamma, protein phosphatase 2B, catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform, protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma), protein phosphatase 3, catalytic subunit, gamma isozyme, serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5533
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PPP3CC
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only